PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C01374.1.p
Common NameEUGRSUZ_C01374, LOC104436817
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 220aa    MW: 24945.6 Da    PI: 9.9389
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C01374.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69.1e-16855148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W +eEd +l+++v+ +G g+W+ ++++ g++R +k+c++rw +yl
  Eucgr.C01374.1.p  8 KGLWKPEEDMILKQYVETHGEGNWAVVSQRSGLKRGGKSCRLRWKNYL 55
                      678*****************************99************97 PP

2Myb_DNA-binding53.74.7e-1761106148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg +++eE++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l
  Eucgr.C01374.1.p  61 RGGMSPEEEDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 106
                       6789******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.538355IPR017930Myb domain
SuperFamilySSF466894.4E-296102IPR009057Homeodomain-like
SMARTSM007172.8E-14757IPR001005SANT/Myb domain
PfamPF002491.1E-14855IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-22962IPR009057Homeodomain-like
CDDcd001672.05E-101155No hitNo description
PROSITE profilePS5129425.19956110IPR017930Myb domain
SMARTSM007171.7E-1660108IPR001005SANT/Myb domain
PfamPF002492.0E-1561106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2463109IPR009057Homeodomain-like
CDDcd001673.96E-1264106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010026Biological Processtrichome differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MKARKIKKGL WKPEEDMILK QYVETHGEGN WAVVSQRSGL KRGGKSCRLR WKNYLRPNIK  60
RGGMSPEEED LIIRMHKLLG NRWSLIAGRL PGRTDNEVKN YWNTHLNKRH LSRKRNSIAS  120
NGRRKDENIC ATLATETAPE VPAPPPMTPP PVIHNGSNDL DAKEAMMTGR KEDRLEDGER  180
FVYGCDMGSP LSMPTSNYSA SVVFDDELLV PWLDSFVFV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-2481097107B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C01374.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010047969.11e-163PREDICTED: transcription factor MYB82-like
SwissprotQ9LTF75e-71MYB82_ARATH; Transcription factor MYB82
TrEMBLA0A059CNL31e-163A0A059CNL3_EUCGR; Uncharacterized protein
STRINGPOPTR_0018s12780.13e-71(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52600.19e-70myb domain protein 82